Rabbit Polyclonal Anti-APOBEC3B Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | APOBEC3B antibody was raised against a 14 amino acid peptide near the amino terminus of human APOBEC3B. |
Rabbit Polyclonal Anti-APOBEC3B Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | APOBEC3B antibody was raised against a 14 amino acid peptide near the amino terminus of human APOBEC3B. |
Rabbit Polyclonal Anti-APOBEC3B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-APOBEC3B antibody: synthetic peptide directed towards the N terminal of human APOBEC3B. Synthetic peptide located within the following region: NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYW |
APOBEC3B Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human APOBEC3B (NP_004891.4). |
Modifications | Unmodified |