Rabbit Polyclonal Anti-APOBEC3B Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | APOBEC3B antibody was raised against a 14 amino acid peptide near the amino terminus of human APOBEC3B. |
Rabbit Polyclonal Anti-APOBEC3B Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | APOBEC3B antibody was raised against a 14 amino acid peptide near the amino terminus of human APOBEC3B. |
Rabbit Polyclonal Anti-APOBEC3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-APOBEC3B antibody: synthetic peptide directed towards the N terminal of human APOBEC3B. Synthetic peptide located within the following region: NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYW |
APOBEC3B Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | Unmodified |