Antibodies

Jump to Filters
View as table Download
ARHGAP1 Rabbit Polyclonal Antibody
TA335074

USD 375.00

5 Days

Rabbit Polyclonal Anti-ARHGAP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARHGAP1 antibody: synthetic peptide directed towards the N terminal of human ARHGAP1. Synthetic peptide located within the following region: MDPLSELQDDLTLDDTSEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSS
ARHGAP1 Rabbit Polyclonal Antibody
TA349502

USD 345.00

In Stock

Rabbit Polyclonal Anti-ARHGAP1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ARHGAP1
ARHGAP1 Rabbit Polyclonal Antibody
TA373648

USD 220.00

3 Weeks

ARHGAP1 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 210-439 of human ARHGAP1 (NP_004299.1).
Modifications Unmodified