Antibodies

Jump to Filters
View as table Download
Asialoglycoprotein Receptor 2 (ASGR2) Rabbit Polyclonal Antibody
TA334287

USD 375.00

In Stock

Rabbit Polyclonal Anti-ASGR2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASGR2 antibody: synthetic peptide directed towards the N terminal of human ASGR2. Synthetic peptide located within the following region: LVVICVTGSQSEGHRGAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGS
Asialoglycoprotein Receptor 2 (ASGR2) Rabbit Polyclonal Antibody
TA334288

USD 310.00

5 Days

Rabbit Polyclonal Anti-ASGR2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASGR2 antibody: synthetic peptide directed towards the N terminal of human ASGR2. Synthetic peptide located within the following region: STLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPV
Asialoglycoprotein Receptor 2 (ASGR2) Mouse Monoclonal Antibody [Clone ID: OTI2A12]
CF505099

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ASGR2 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Asialoglycoprotein Receptor 2 (ASGR2) Rabbit Polyclonal Antibody
TA373736

USD 220.00

3 Weeks

ASGR2 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 131-287 of human ASGR2 (NP_550435.1).
Modifications Unmodified
Asialoglycoprotein Receptor 2 (ASGR2) Rabbit Polyclonal Antibody
TA373737

USD 220.00

3 Weeks

ASGR2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 58-287 of human ASGR2 (NP_550435.1).
Modifications Unmodified
Asialoglycoprotein Receptor 2 (ASGR2) Mouse Monoclonal Antibody [Clone ID: OTI2A12]
TA505099

USD 379.00

In Stock

ASGR2 (Asialoglycoprotein Receptor 2) mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Asialoglycoprotein Receptor 2 (ASGR2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A12]
TA505099AM

USD 420.00

5 Days

ASGR2 mouse monoclonal antibody,clone 2A12, Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin
Asialoglycoprotein Receptor 2 (ASGR2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A12]
TA505099BM

USD 420.00

5 Days

ASGR2 mouse monoclonal antibody,clone 2A12, HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP
Asialoglycoprotein Receptor 2 (ASGR2) Mouse Monoclonal Antibody [Clone ID: OTI2A12]
TA505099S

USD 159.00

In Stock

ASGR2 (Asialoglycoprotein Receptor 2) mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated