Asialoglycoprotein Receptor 2 (ASGR2) Rabbit Polyclonal Antibody

CAT#: TA334288

Rabbit Polyclonal Anti-ASGR2 Antibody

Product Images

WB Suggested Anti-ASGR2 Antibody Titration: 4.0 ug/ml; Positive Control: HepG2 cell lysateASGR2 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Human Spleen

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ASGR2 antibody: synthetic peptide directed towards the N terminal of human ASGR2. Synthetic peptide located within the following region: STLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: asialoglycoprotein receptor 2
• Database Link:
  NP_001172
  Entrez Gene 433 Human
  UniProt ID P07307
• Background: ASGR2 is a cell surface receptor that binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface. There are four alternatively spliced transcript variants of this gene. This gene has multiple polyadenylation sites.
• Synonyms: ASGP-R2; ASGPR2; CLEC4H2; HBXBP; HL-2
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane