Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ACCN3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACCN3 antibody: synthetic peptide directed towards the N terminal of human ACCN3. Synthetic peptide located within the following region: VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL |
Rabbit polyclonal Anti-ASIC3
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide KPRSGLEEAQRRQAS(C), corresponding to amino acid residues 2-16 of rat ASIC3.Intracellular, N-terminus. |
ASIC3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ACCN3 |
ASIC3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ACCN3 |
ASIC3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 62-320 of human ASIC3 (NP_064717.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ASIC3