ASIC3 Rabbit Polyclonal Antibody

CAT#: TA338543

Rabbit Polyclonal Anti-ACCN3 Antibody

Product Images

WB Suggested Anti-ACCN3 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Kidney

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACCN3 antibody: synthetic peptide directed towards the N terminal of human ACCN3. Synthetic peptide located within the following region: VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: acid sensing ion channel subunit 3
• Database Link:
  NP_004760
  Entrez Gene 9311 Human
  UniProt ID Q9UHC3
• Background: This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene is an acid sensor and may play an important role in the detection of lasting pH changes. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 2 has been observed as proton-gated channels sensitive to gadolinium. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2012]
• Synonyms: ACCN3; DRASIC; SLNAC1; TNaC1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 87%; Rat: 87%; Mouse: 87%; Rabbit: 87%; Dog: 80%; Horse: 80%; Bovine: 80%; Guinea pig: 80%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other