Antibodies

View as table Download

Rabbit Polyclonal Anti-ASPN Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASPN antibody: synthetic peptide directed towards the middle region of human ASPN. Synthetic peptide located within the following region: NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK

Rabbit polyclonal ASPN Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ASPN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 242-269 amino acids from the Central region of human ASPN.

Goat Polyclonal Antibody against ASPN

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-IHENKVKKIQKDT, from the internal region of the protein sequence according to NP_060150.3.

Rabbit Polyclonal Anti-ASPN Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ASPN

ASPN Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified