Antibodies

Jump to Filters
View as table Download
ASZ1 Rabbit Polyclonal Antibody
TA340257

USD 375.00

5 Days

Rabbit Polyclonal Anti-ASZ1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASZ1 antibody: synthetic peptide directed towards the middle region of human ASZ1. Synthetic peptide located within the following region: GKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDR
ASZ1 Rabbit Polyclonal Antibody
TA373757

USD 220.00

3 Weeks

ASZ1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-350 of human ASZ1 (NP_570124.1).
Modifications Unmodified