ASZ1 Rabbit Polyclonal Antibody

CAT#: TA340257

Rabbit Polyclonal Anti-ASZ1 Antibody

Product Images

WB Suggested Anti-ASZ1 Antibody; Titration: 1.0 ug/ml; Positive Control: THP-1 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ASZ1 antibody: synthetic peptide directed towards the middle region of human ASZ1. Synthetic peptide located within the following region: GKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: ankyrin repeat, SAM and basic leucine zipper domain containing 1
• Database Link:
  NP_570124
  Entrez Gene 136991 Human
  UniProt ID Q8WWH4
• Background: ASZ1 plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity.ASZ1 acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Its association with pi-bodies suggests a participation in the primary piRNAs metabolic process.ASZ1 is required prior to the pachytene stage to facilitate the production of multiple types of piRNAs, including those associated with repeats involved in regulation of retrotransposons.ASZ1 may act by mediating protein-protein interactions during germ cell maturation.
• Synonyms: ALP1; ANKL1; C7orf7; CT1.19; GASZ; Orf3
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Sheep: 93%; Bovine: 93%