Rabbit Polyclonal Anti-ATCAY Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATCAY antibody is: synthetic peptide directed towards the C-terminal region of Human ATCAY. Synthetic peptide located within the following region: LQYEEERLKARRESARPQPEFVLPRSEEKPEVAPVENRSALVSEDQETSM |
Rabbit Polyclonal Anti-ATCAY Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATCAY antibody: synthetic peptide directed towards the C terminal of human ATCAY. Synthetic peptide located within the following region: LIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKPEVAPVEN |
ATCAY Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human ATCAY (NP_149053.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China