Rabbit Polyclonal ATP2C1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ATP2C1 antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human ATP2C1. |
Rabbit Polyclonal ATP2C1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ATP2C1 antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human ATP2C1. |
Rabbit Polyclonal Anti-ATP2C1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATP2C1 antibody: synthetic peptide directed towards the C terminal of human ATP2C1. Synthetic peptide located within the following region: TKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILGLA |
Rabbit Polyclonal Anti-ATP2C1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ATP2C1 |
ATP2C1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ATP2C1 |
ATP2C1 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 400-660 of human ATP2C1 (NP_001186114.1). |
Modifications | Unmodified |