Antibodies

Jump to Filters
View as table Download
ATP6V0D2 Rabbit Polyclonal Antibody
TA329774

USD 375.00

5 Days

Rabbit polyclonal Anti-ATP6V0D2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V0D2 antibody: synthetic peptide directed towards the middle region of human ATP6V0D2. Synthetic peptide located within the following region: MNVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPI
ATP6V0D2 Rabbit Polyclonal Antibody
TA329773

USD 375.00

5 Days

Rabbit polyclonal Anti-ATP6V0D2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V0D2 antibody: synthetic peptide directed towards the middle region of human ATP6V0D2. Synthetic peptide located within the following region: GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
ATP6V0D2 Mouse Monoclonal Antibody [Clone ID: OTI2D6]
CF812166

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ATP6V0D2 mouse monoclonal antibody,clone OTI2D6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Atp6v0d2 Rabbit Polyclonal Antibody
TA363265

USD 360.00

5 Days

ATP6V0D2 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse ATP6V0D2
ATP6V0D2 Mouse Monoclonal Antibody [Clone ID: OTI2D6]
TA812166

USD 379.00

In Stock

ATP6V0D2 mouse monoclonal antibody,clone OTI2D6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ATP6V0D2 Mouse Monoclonal Antibody [Clone ID: OTI2D6]
TA812166S

USD 159.00

2 Days

ATP6V0D2 mouse monoclonal antibody,clone OTI2D6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated