Antibodies

Jump to Filters
View as table Download
ATP6V0E2 Rabbit Antibody
TA331647

USD 375.00

5 Days

Rabbit Polyclonal Anti-ATP6V0E2 Antibody

Reactivities Human, Horse, Rabbit, Rat, Guinea pig, Dog, Bovine, Mouse, Zebrafish
ATP6V0E2 Rabbit Polyclonal Antibody
TA339996

USD 375.00

5 Days

Rabbit Polyclonal Anti-ATP6V0E2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V0E2 antibody: synthetic peptide directed towards the middle region of human ATP6V0E2. Synthetic peptide located within the following region: TVAPLSLTTPSSGPSPTQLCLVTSSLLLAPRDPDPQGLPGSWKSSQSSQP