ATP6V0E2 Rabbit Antibody

CAT#: TA331647

Rabbit Polyclonal Anti-ATP6V0E2 Antibody

Specifications

Product Data

• Reactivities: Human, Horse, Rabbit, Rat, Guinea pig, Dog, Bovine, Mouse, Zebrafish
• Host: Rabbit
• Isotype: IgG
• Immunogen: The immunogen for Anti-ATP6V0E2 Antibody is: synthetic peptide directed towards the N-terminal region of Human ATP6V0E2. Synthetic peptide located within the following region: GPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNETI
• Formulation: Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Database Link:
  NP_660265
  Entrez Gene 155066 Human
• Background: Multisubunit vacuolar-type proton pumps, or H(+)-ATPases, acidify various intracellular compartments, such as vacuoles, clathrin-coated and synaptic vesicles, endosomes, lysosomes, and chromaffin granules. H(+)-ATPases are also found in plasma membranes of specialized cells, where they play roles in urinary acidification, bone resorption, and sperm maturation. Multiple subunits form H(+)-ATPases, with proteins of the V1 class hydrolyzing ATP for energy to transport H+, and proteins of the V0 class forming an integral membrane domain through which H+ is transported. ATP6V0E2 encodes an isoform of the H(+)-ATPase V0 e subunit, an essential proton pump component.
• Synonyms: ATP6V0E2L; C7orf32
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Pathways: Epithelial cell signaling in Helicobacter pylori infection, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection