Antibodies

Jump to Filters
View as table Download
C2orf28 (ATRAID) Rabbit Polyclonal Antibody
TA329155

USD 375.00

5 Days

Rabbit Polyclonal anti-C2orf28 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2orf28 antibody: synthetic peptide directed towards the C terminal of human C2orf28. Synthetic peptide located within the following region: VCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS
C2orf28 (ATRAID) Rabbit Polyclonal Antibody
TA355839

USD 360.00

5 Days

C2orf28 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated