C2orf28 (ATRAID) Rabbit Polyclonal Antibody

CAT#: TA329155

Rabbit Polyclonal anti-C2orf28 antibody

Product Images

WB Suggested Anti-C2orf28 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C2orf28 antibody: synthetic peptide directed towards the C terminal of human C2orf28. Synthetic peptide located within the following region: VCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: all-trans retinoic acid induced differentiation factor
• Database Link:
  NP_057169
  Entrez Gene 51374 Human
  UniProt ID Q6UW56
• Background: The exact function of C2orf28 remains unknown.This gene is thought to be involved in apoptosis, and may also be involved in hematopoietic development and differentiation. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Synonyms: APR--3; APR-3; APR3; C2orf28; HSPC013; p18; PRO240
• Note: Immunogen sequence homology: Human: 100%; Dog: 87%; Pig: 87%; Rat: 87%; Mouse: 87%; Bovine: 87%; Rabbit: 87%

Reference Data

• Protein Families: Druggable Genome, Transmembrane