Antibodies

Jump to Filters
View as table Download
Beta 1,4 galactosyltransferase 6 (B4GALT6) (C-term) Rabbit Polyclonal Antibody
AP50332PU-N

USD 450.00

2 Weeks

Beta 1,4 galactosyltransferase 6 (B4GALT6) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 322-350 amino acids from the C-terminal region of human B4GALT6
B4galt6 Rabbit Polyclonal Antibody
TA339432

USD 375.00

5 Days

Rabbit Polyclonal Anti-B4galt6 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-B4galt6 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GGEDDDLWNRVHYAGYNVTRPEGDLGKYISIPHHHRGEVQFLGRYKLLRY