B4galt6 Rabbit Polyclonal Antibody

CAT#: TA339432

Rabbit Polyclonal Anti-B4galt6 Antibody

Product Images

WB Suggested Anti-B4galt6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Mouse Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-B4galt6 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GGEDDDLWNRVHYAGYNVTRPEGDLGKYISIPHHHRGEVQFLGRYKLLRY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 6
• Database Link:
  NP_062711
  Entrez Gene 56386 Mouse
  UniProt ID Q9WVK5
• Background: Required for the biosynthesis of glycosphingolipids.
• Synonyms: b4Gal-T6; Beta4Gal-T6; beta4GalT-VI
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 93%; Guinea pig: 93%