HSPC142 (BABAM1) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 116-143 amino acids from the Central region of Human HSPC142. |
HSPC142 (BABAM1) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 116-143 amino acids from the Central region of Human HSPC142. |
Rabbit Polyclonal Anti-BABAN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BABAN1 antibody: synthetic peptide directed towards the N terminal of human BABAN1. Synthetic peptide located within the following region: DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIR |
Rabbit polyclonal anti-BABAM1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BABAM1 |
Rabbit polyclonal anti-BABAM1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BABAM1 |