Rabbit Polyclonal Anti-BARX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BARX2 Antibody: synthetic peptide directed towards the N terminal of human BARX2. Synthetic peptide located within the following region: PSLRAYPLLSVITRQPTVISHLVPATPGIAQALSCHQVTEAVSAEAPGGE |
Rabbit Polyclonal Anti-Barx2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Barx2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LSKETCDYFEKLSLYSVCPSLVVRPKPLHSCTGSPSLRAYPLLSVITRQP |
Rabbit Polyclonal Anti-BARX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BARX2 antibody: synthetic peptide directed towards the N terminal of human BARX2. Synthetic peptide located within the following region: HCHAELRLSSPGQLKAARRRYKTFMIDEILSKETCDYFEKLSLYSVCPSL |
Rabbit Polyclonal Anti-BARX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BARX2 antibody is: synthetic peptide directed towards the C-terminal region of Human BARX2. Synthetic peptide located within the following region: EEIEAEEKMNSQAQGQEQLEPSQGQEELCEAQEPKARDVPLEMAEPPDPP |
Germany
Japan
United Kingdom
China