Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-BAZ1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BAZ1B antibody: synthetic peptide directed towards the middle region of human BAZ1B. Synthetic peptide located within the following region: EQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQK |
Rabbit polyclonal anti-Williams Syndrome Transcription Factor (WSTF) antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Williams Syndrome Transcription Factor (WSTF) |
Carrier-free (BSA/glycerol-free) BAZ1B mouse monoclonal antibody,clone OTI3B8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-BAZ1B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human BAZ1B |
WSTF Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human WSTF (NP_115784.1). |
| Modifications | Unmodified |
WSTF Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human WSTF (NP_115784.1). |
| Modifications | Unmodified |
BAZ1B mouse monoclonal antibody,clone OTI3B8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
BAZ1B mouse monoclonal antibody,clone OTI3B8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
BAZ1B mouse monoclonal antibody,clone OTI3B8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
BAZ1B mouse monoclonal antibody,clone OTI3B8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-BAZ1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BAZ1B |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
Active filters
Target Symbol
- BAZ1B