Rabbit Polyclonal Anti-BHLHB5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BHLHB5 antibody: synthetic peptide directed towards the N terminal of human BHLHB5. Synthetic peptide located within the following region: LPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPR |
Rabbit Polyclonal Anti-BHLHB5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BHLHB5 antibody: synthetic peptide directed towards the N terminal of human BHLHB5. Synthetic peptide located within the following region: LPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPR |
Germany
Japan
United Kingdom
China