BHLHB5 (BHLHE22) Rabbit Polyclonal Antibody

CAT#: TA330534

Rabbit Polyclonal Anti-BHLHB5 Antibody

Product Images

WB Suggested Anti-BHLHB5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BHLHB5 antibody: synthetic peptide directed towards the N terminal of human BHLHB5. Synthetic peptide located within the following region: LPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: basic helix-loop-helix family member e22
• Database Link:
  NP_689627
  Entrez Gene 27319 Human
  UniProt ID Q8NFJ8
• Background: BHLHB5 is a member of family of basic helix-loop-helix (bHLH) transcription factors. Members of this family have been implicated in many aspects of neural development, including cell growth, differentiation, and cell migration.
• Synonyms: Beta3; BHLHB5; CAGL85; TNRC20
• Note: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome