Antibodies

Jump to Filters
View as table Download
BLOC1S1 Rabbit Polyclonal Antibody
TA335195

USD 375.00

5 Days

Rabbit Polyclonal Anti-BLOC1S1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BLOC1S1 antibody is: synthetic peptide directed towards the N-terminal region of Human BLOC1S1. Synthetic peptide located within the following region: SPQPDVTMLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLN
BLOC1S1 Rabbit Polyclonal Antibody
TA374018

USD 220.00

3 Weeks

BLOC1S1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-153 of human BLOC1S1 (NP_001478.2).
Modifications Unmodified