BLOC1S1 Rabbit Polyclonal Antibody

CAT#: TA335195

Rabbit Polyclonal Anti-BLOC1S1 Antibody

Product Images

Host: Rabbit; Target Name: BLOC1S1; Sample Tissue: Lung Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BLOC1S1 antibody is: synthetic peptide directed towards the N-terminal region of Human BLOC1S1. Synthetic peptide located within the following region: SPQPDVTMLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: biogenesis of lysosomal organelles complex 1 subunit 1
• Database Link:
  NP_001478
  Entrez Gene 2647 Human
  UniProt ID P78537
• Background: BLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules.
• Synonyms: BLOS1; GCN5L1; MICoA; RT14
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%