Rabbit polyclonal BLZF1 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This BLZF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 156-184 amino acids from the Central region of human BLZF1. |
Rabbit Polyclonal Anti-BLZF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BLZF1 antibody: synthetic peptide directed towards the N terminal of human BLZF1. Synthetic peptide located within the following region: MTTKNLETKVTVTSSPIRGAGDGMETEEPPKSVEVTSGVQSRKHHSLQSP |
Rabbit Polyclonal Anti-BLZF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BLZF1 antibody: synthetic peptide directed towards the C terminal of human BLZF1. Synthetic peptide located within the following region: DPVTCKESSPDNPFFESSPTTLLATKKNIGRFHPYTRYENITFNCCNHCR |
Rabbit Polyclonal Anti-BLZF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BLZF1 antibody: synthetic peptide directed towards the N terminal of human BLZF1. Synthetic peptide located within the following region: EKAMEVKAVRILVPKAAITHDIPNKNTKVKSLGHHKGEFLGQSEGVIEPN |
Carrier-free (BSA/glycerol-free) BLZF1 mouse monoclonal antibody,clone OTI3E2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BLZF1 mouse monoclonal antibody,clone OTI3G4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
BLZF1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-400 of human BLZF1 (NP_003657.1). |
| Modifications | Unmodified |
BLZF1 mouse monoclonal antibody,clone OTI3E2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
BLZF1 mouse monoclonal antibody,clone OTI3E2, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
BLZF1 mouse monoclonal antibody,clone OTI3E2, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
BLZF1 mouse monoclonal antibody,clone OTI3E2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
BLZF1 mouse monoclonal antibody,clone OTI3G4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
BLZF1 mouse monoclonal antibody,clone OTI3G4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
BLZF1 mouse monoclonal antibody,clone OTI3G4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
BLZF1 mouse monoclonal antibody,clone OTI3G4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
