BLZF1 Rabbit Polyclonal Antibody
Other products for "BLZF1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-BLZF1 antibody: synthetic peptide directed towards the N terminal of human BLZF1. Synthetic peptide located within the following region: EKAMEVKAVRILVPKAAITHDIPNKNTKVKSLGHHKGEFLGQSEGVIEPN |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 45 kDa |
Gene Name | basic leucine zipper nuclear factor 1 |
Database Link | |
Background | BLZF1 is required for normal Golgi structure and for protein transport from the endoplasmic reticulum (ER) through the Golgi apparatus to the cell surface. |
Synonyms | GOLGIN-45; JEM-1; JEM-1s; JEM1 |
Note | Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 92%; Rat: 92%; Bovine: 92%; Pig: 85%; Rabbit: 85%; Guinea pig: 85%; Mouse: 83% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.