BLZF1 Rabbit Polyclonal Antibody

CAT#: TA334720

Rabbit Polyclonal Anti-BLZF1 Antibody

Product Images

WB Suggested Anti-BLZF1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human kidney

• 

  Host: Rabbit; Target Name: BLZF1; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml; BLZF1 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BLZF1 antibody: synthetic peptide directed towards the N terminal of human BLZF1. Synthetic peptide located within the following region: EKAMEVKAVRILVPKAAITHDIPNKNTKVKSLGHHKGEFLGQSEGVIEPN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: basic leucine zipper nuclear factor 1
• Database Link:
  NP_003657
  Entrez Gene 8548 Human
  UniProt ID Q9H2G9
• Background: BLZF1 is required for normal Golgi structure and for protein transport from the endoplasmic reticulum (ER) through the Golgi apparatus to the cell surface.
• Synonyms: GOLGIN-45; JEM-1; JEM-1s; JEM1
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 92%; Rat: 92%; Bovine: 92%; Pig: 85%; Rabbit: 85%; Guinea pig: 85%; Mouse: 83%

Reference Data

• Protein Families: Transcription Factors