Antibodies

View as table Download

HSPC142 (BABAM1) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 116-143 amino acids from the Central region of Human HSPC142.

Rabbit Polyclonal Anti-BABAN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BABAN1 antibody: synthetic peptide directed towards the N terminal of human BABAN1. Synthetic peptide located within the following region: DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIR

Rabbit polyclonal anti-BABAM1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BABAM1

Rabbit polyclonal anti-BABAM1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BABAM1