Rabbit Polyclonal BACE Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | BACE antibody was raised against a peptide corresponding to 17 amino acids at the carboxy terminus of human BACE. |
Rabbit Polyclonal BACE Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | BACE antibody was raised against a peptide corresponding to 17 amino acids at the carboxy terminus of human BACE. |
Rabbit Polyclonal Anti-BACE1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BACE1 antibody: synthetic peptide directed towards the N terminal of human BACE1. Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY |
Rabbit Polyclonal Anti-BACE1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | BACE1 / BACE antibody was raised against synthetic 15 amino acid peptide from internal region of human BACE1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Opossum, Guinea pig (100%); Platypus (87%); Xenopus, Pufferfish, Zebrafish, Stickleback (80%). |
Rabbit Polyclonal Anti-BACE1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | BACE1 / BACE antibody was raised against synthetic 18 amino acid peptide from C-terminus of human BACE1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Mouse, Rat, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Guinea pig (94%); Opossum (89%); Turkey, Chicken, Platypus (83%). |
Rabbit Polyclonal Anti-Bace1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Bace1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKK |
Anti-BACE1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human beta-site APP-cleaving enzyme 1 |
BACE1 Rabbit polyclonal Antibody
| Applications | ELISA, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |