Antibodies

View as table Download

BANF1 mouse monoclonal antibody, clone 3F10-4G12

Applications ELISA, IHC, WB
Reactivities Human

Rabbit Polyclonal BANF1 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen BANF1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human BANF1.

Rabbit Polyclonal BANF1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen BANF1 antibody was raised against a 19 amino acid peptide from near the amino terminus of human BANF1.

Rabbit Polyclonal Anti-BANF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BANF1 antibody is: synthetic peptide directed towards the middle region of Human BANF1. Synthetic peptide located within the following region: FDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAF

BANF1 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified