BANF1 Rabbit Polyclonal Antibody

CAT#: TA338203

Rabbit Polyclonal Anti-BANF1 Antibody

Product Images

WB Suggested Anti-BANF1 Antibody; Titration: 1.0 ug/ml; Positive Control: MCF7 Whole Cell BANF1 is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BANF1 antibody is: synthetic peptide directed towards the middle region of Human BANF1. Synthetic peptide located within the following region: FDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 10 kDa
• Gene Name: barrier to autointegration factor 1
• Database Link:
  NP_003851
  Entrez Gene 8815 Human
  UniProt ID O75531
• Background: The protein encoded by this gene was first identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The protein forms a homodimer which localizes to both the nucleus and cytoplasm and is specifically associated with chromosomes during mitosis. This protein binds to double stranded DNA in a non-specific manner and also binds to LEM-domain containing proteins of the nuclear envelope. This protein is thought to facilitate nuclear reassembly by binding with both DNA and inner nuclear membrane proteins and thereby recruit chromatin to the nuclear periphery. Alternative splicing results in multiple transcript variants encoding the same protein.
• Synonyms: BAF; BCRP1; D14S1460; NGPS
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 91%