Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-BATF antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BATF. |
Antibodies
View as table Download
BATF (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 6-35 amino acids from the N-terminal region of human BATF |
Rabbit Polyclonal Anti-BATF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BATF antibody: synthetic peptide directed towards the middle region of human BATF. Synthetic peptide located within the following region: KNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTS |
Rabbit Polyclonal Anti-BATF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BATF antibody: synthetic peptide directed towards the N terminal of human BATF. Synthetic peptide located within the following region: PHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKA |
BATF Antibody - N-terminal
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Rat BATF |
BATF rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
BATF Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human BATF (NP_006390.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- BATF