Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-BMP8A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP8A antibody is: synthetic peptide directed towards the middle region of Human BMP8A. Synthetic peptide located within the following region: VRPLRRRQPKKTNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLG |
Rabbit Polyclonal Anti-BMP8A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP8A antibody is: synthetic peptide directed towards the N-terminal region of Human BMP8A. Synthetic peptide located within the following region: RPPPGCPQRRLGARERRDVQREILAVLGLPGRPRPRAPPAASRLPASAPL |
BMP8A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human BMP8A |
BMP8A Rabbit polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from the Internal region of human BMP8A. AA range:241-290 |
Active filters
Target Symbol
- BMP8A