BMP8A Rabbit Polyclonal Antibody

CAT#: TA337727

Rabbit Polyclonal Anti-BMP8A Antibody

Product Images

Host: Rabbit; Target Name: BMP8A; Sample Tissue: 293T Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BMP8A antibody is: synthetic peptide directed towards the middle region of Human BMP8A. Synthetic peptide located within the following region: VRPLRRRQPKKTNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: bone morphogenetic protein 8a
• Database Link:
  NP_861525
  Entrez Gene 353500 Human
  UniProt ID Q7Z5Y6
• Background: The function of this protein remains unknown.
• Synonyms: FLJ14351; FLJ45264
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 83%; Pig: 83%; Rat: 83%; Mouse: 83%; Rabbit: 83%; Guinea pig: 83%; Horse: 75%

Reference Data

• Protein Families: Secreted Protein
• Protein Pathways: Hedgehog signaling pathway, TGF-beta signaling pathway