Rabbit Polyclonal Anti-BRD7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BRD7 antibody: synthetic peptide directed towards the C terminal of human BRD7. Synthetic peptide located within the following region: KELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDV |
BRD7 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human BRD7 |
BRD7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human BRD7 (NP_037395.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
