Antibodies

View as table Download

Rabbit Polyclonal Anti-BRD7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BRD7 antibody: synthetic peptide directed towards the C terminal of human BRD7. Synthetic peptide located within the following region: KELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDV

BRD7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BRD7

BRD7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BRD7

BRD7 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Modifications Unmodified