Antibodies

Jump to Filters
View as table Download
BRD7 Rabbit Polyclonal Antibody
TA343710

USD 475.00

5 Days

Rabbit Polyclonal Anti-BRD7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BRD7 antibody: synthetic peptide directed towards the C terminal of human BRD7. Synthetic peptide located within the following region: KELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDV
BRD7 Rabbit Polyclonal Antibody
TA365526

USD 380.00

4 Weeks

BRD7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BRD7
BRD7 Rabbit Polyclonal Antibody
TA369838

USD 380.00

4 Weeks

BRD7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BRD7
BRD7 Rabbit Polyclonal Antibody
TA374077

USD 475.00

3 Weeks

BRD7 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Modifications Unmodified