BRD7 Rabbit Polyclonal Antibody

CAT#: TA343710

Rabbit Polyclonal Anti-BRD7 Antibody

Product Images

WB Suggested Anti-BRD7 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate; BRD7 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Host: Rabbit; Target Name: BRD7; Sample Tissue: Jurkat; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 2.5 ug/mL; Peptide Concentration: 2.0 ug/mL; Lysate Quantity: 25 ug/lane; Gel Concentration: 12%

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BRD7 antibody: synthetic peptide directed towards the C terminal of human BRD7. Synthetic peptide located within the following region: KELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 74 kDa
• Gene Name: bromodomain containing 7
• Database Link:
  NP_037395
  Entrez Gene 29117 Human
  UniProt ID Q9NPI1
• Background: BRD7 is an activator of the Wnt signaling pathway in a DVL1-dependent manner by negatively regulating the GSK3B phosphotransferase activity. It induces dephosphorylation of GSK3B at 'Tyr-216'.
• Synonyms: BP75; CELTIX1; NAG4
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Guinea pig: 93%; Dog: 86%; Rat: 86%; Horse: 79%; Rabbit: 79%