Rabbit Polyclonal Anti-BRF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BRF1 antibody: synthetic peptide directed towards the C terminal of mouse BRF1. Synthetic peptide located within the following region: GSPPRDDSQPPERASTKKLSRRKRATTRNSADPGTSTGKRLRPLLSAQPA |
BRF1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 313-342 amino acids from the Central region of human BRF1 |
Rabbit Polyclonal Anti-BRF1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for anti-BRF1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PALGAEPIKPSAVLVESGPVSYHPEEDADEEDAEDEDGEPCVSALQMMGG |
BRF1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Germany
Japan
United Kingdom
China
