Brf1 Rabbit Polyclonal Antibody

CAT#: TA329948

Rabbit Polyclonal Anti-BRF1 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Brf1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-BRF1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PALGAEPIKPSAVLVESGPVSYHPEEDADEEDAEDEDGEPCVSALQMMGG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 22 kDa
Gene Name BRF1, RNA polymerase III transcription initiation factor 90 kDa subunit
Background BRF1 is one of the three subunits of the RNA polymerase III transcription factor complex. This complex plays a central role in transcription initiation by RNA polymerase III on genes encoding tRNA, 5S rRNA, and other small structural RNAs.
Synonyms BRF; BRF-1; FLJ42674; FLJ43034; GTF3B; hBRF; hTFIIIB90; MGC105048; TAF3B2; TAF3C; TAFIII90; TF3B90; TFIIIB90
Note Immunogen sequence homology: Rat: 100%; Mouse: 100%; Dog: 92%; Yeast: 90%; Bovine: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.