Antibodies

Jump to Filters
View as table Download
WDR9 (BRWD1) Rabbit Polyclonal Antibody
TA344091

USD 475.00

5 Days

Rabbit Polyclonal Anti-BRWD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BRWD1 antibody: synthetic peptide directed towards the N terminal of human BRWD1. Synthetic peptide located within the following region: MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK
WDR9 (BRWD1) Rabbit Polyclonal Antibody
TA351924

USD 345.00

In Stock

Rabbit Polyclonal Anti-BRWD1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human BRWD1
BRWD1 Rabbit Polyclonal Antibody
TA367369

USD 380.00

4 Weeks

BRWD1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human BRWD1
WDR9 (BRWD1) Rabbit Polyclonal Antibody
TA374091

USD 220.00

3 Weeks

BRWD1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human BRWD1 (NP_001007247.1).
Modifications Unmodified