Antibodies

Jump to Filters
View as table Download
C11orf74 (C-term) Rabbit Polyclonal Antibody
AP50438PU-N

USD 450.00

2 Weeks

C11orf74 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 197-228 amino acids from the C-terminal region of human C11orf74
C11orf74 Rabbit Polyclonal Antibody
TA340304

USD 375.00

5 Days

Rabbit Polyclonal Anti-C11orf74 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C11orf74 antibody: synthetic peptide directed towards the middle region of human C11orf74. Synthetic peptide located within the following region: VQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSCD