C11orf74 Rabbit Polyclonal Antibody

CAT#: TA340304

Rabbit Polyclonal Anti-C11orf74 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "C11orf74"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-C11orf74 antibody: synthetic peptide directed towards the middle region of human C11orf74. Synthetic peptide located within the following region: VQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSCD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 25 kDa
Gene Name chromosome 11 open reading frame 74
Background The exact function of C11orf74 remains unknown.
Synonyms HEPIS
Note Immunogen Sequence Homology: Human: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.