Germany
Japan
United Kingdom
China
C1RL (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 160-190 amino acids from the Central region of human C1RL |
Antibodies
View as table Download
Rabbit Polyclonal Anti-C1RL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C1RL Antibody is: synthetic peptide directed towards the middle region of Human C1RL. Synthetic peptide located within the following region: KVQNHCQEPYYQAAAAGALTCATPGTWKDRQDGEEVLQCMPVCGRPVTPI |
C1RL Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human C1RL |
C1RL Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthesized peptide derived from human C1RL. at AA range: 371-420 |
Active filters
Target Symbol
- C1RL