Complement C3 (C3) rabbit polyclonal antibody, Serum
| Applications | ID, IP |
| Reactivities | Human |
| Immunogen | C3b (C3c+C3d) has a molecular weight of 170,000. The protein is isolated and purified from pooled normal human serum by precipitation techniques, followed by chromatographical methods. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Anti-C2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C2 antibody: synthetic peptide directed towards the middle region of human C2. Synthetic peptide located within the following region: INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ |
C2 rabbit polyclonal antibody, Serum
| Applications | ID, IP |
| Reactivities | Human |
| Immunogen | The C2 component of human complement is a single-chain polypeptide with a molecular weight of 110,000. It is present in plasma in an average concentration of 25 μg/ml. The activated form of C2 combines with the activated C4 to form a complex with C3-convertase activity in the classical pathway of complement activation. C2 is isolated as a homogenous protein for use in the antiserum production. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
C3 rabbit polyclonal antibody, Serum
| Applications | ID, IHC, IP |
| Reactivities | Human |
| Immunogen | C3c is the major fragment resulting from the C3 cleavage by C3 convertase and factor i. It is composed of an intact beta chain bound to two fragments of the alpha chain. The protein is isolated and purified from pooled normal human serum by precipitation techniques, followed by chromatographical methods. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Anti-C2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS |
Complement C4A (C4A) rabbit polyclonal antibody, Serum
| Applications | ID, IP |
| Reactivities | Human |
| Immunogen | C4 and C2 represent substrates for activated C1. Both components are present in serum in an inert form. C4 is composed of 3 polypeptide chains of three different types, , , . One of the chains is cleaved by the action of activated C1, resulting in activation of C4 exposing an binding site for the next component in the sequence, C2. C4 has a molecular weight of 205.000 and is present in plasma in an average concentration of 600 μg/ml. The activation of C4 yields two peptide fragments: C4a (MW 8,000) and C4b (MW 198,000). This process shows a considerable degree of similarity to the activation of the components C3 and C5. The C4 is isolated as a homogenous protein for use in antiserum production. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
C3 rabbit polyclonal antibody, Serum
| Applications | ID, IP, R |
| Reactivities | Guinea Pig |
| Immunogen | The protein is isolated and purified from pooled normal Guinea Pig serum by precipitation techniques, followed by chromatographical methods. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Complement C3 (C3) rabbit polyclonal antibody, Serum
| Applications | ID, IP |
| Reactivities | Human |
| Immunogen | C3a is a component of complement C3 produced by its activation. It has a molecular weight of 8,900. The protein is isolated and purified from pooled normal Human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
C4BPA rabbit polyclonal antibody, Serum
| Applications | ID, IP |
| Reactivities | Human |
| Immunogen | C4-binding protein is a plasma protein with a molecular weight of 500,000 and consists of 6 chains. Its concentration in serum is about 250 μg/ml. It is one of the inhibitors of the complement activation system. The protein combines up to six molecules of C4b at or near the C2 combining site and is thus preventing further association with C2. It has been isolated as a homogenous protein for use in the antiserum production. Freund’s complete adjuvant is used in the first step of the immunization procedure |
C2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Hamster, Human |
| Immunogen | KLH conjugated synthetic peptide between 147-176 amino acids from the N-terminal region of human C2 |
C2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human C2 |
C2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human C2 |
C2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 453-752 of human C2 (NP_000054.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
