Rabbit Polyclonal Anti-C5orf22 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C5orf22 antibody is: synthetic peptide directed towards the middle region of Human C5orf22. Synthetic peptide located within the following region: QLDVIMVKPYKLCNNQEENDAVSSAKKPKLALEDSENTASTNCDSSSEGL |
Rabbit Polyclonal Anti-C5orf22 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C5orf22 antibody is: synthetic peptide directed towards the middle region of Human C5orf22. Synthetic peptide located within the following region: KPKLALEDSENTASTNCDSSSEGLEKDTATQRSDQTCLEPSCSCSSENQE |
Germany
Japan
United Kingdom
China