C5orf22 Rabbit Polyclonal Antibody

CAT#: TA330676

Rabbit Polyclonal Anti-C5orf22 Antibody

Product Images

Host: Rabbit; Target Name: C5orf22; Sample Tissue: Fetal Brain lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C5orf22 antibody is: synthetic peptide directed towards the middle region of Human C5orf22. Synthetic peptide located within the following region: QLDVIMVKPYKLCNNQEENDAVSSAKKPKLALEDSENTASTNCDSSSEGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: chromosome 5 open reading frame 22
• Database Link:
  NP_060826
  Entrez Gene 55322 Human
  UniProt ID Q49AR2
• Background: The function of this protein remains unknown.
• Synonyms: DKFZp667N066; FLJ11193; FLJ23805; MGC33010
• Note: Dog: 100%; Human: 100%; Horse: 93%; Bovine: 93%; Pig: 86%; Rabbit: 86%; Rat: 85%