Antibodies

View as table Download

CALML6 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CALML6

Rabbit Polyclonal Anti-CALML6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CALML6 Antibody is: synthetic peptide directed towards the C-terminal region of Human CALML6. Synthetic peptide located within the following region: YHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQ

CALML6 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CALML6