CALML6 Rabbit Polyclonal Antibody

CAT#: TA331664

Rabbit Polyclonal Anti-CALML6 Antibody

Product Images

Host: Rabbit; Target Name: CALML6; Sample Tissue: Placenta lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CALML6 Antibody is: synthetic peptide directed towards the C-terminal region of Human CALML6. Synthetic peptide located within the following region: YHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: calmodulin like 6
• Database Link:
  NP_619650
  Entrez Gene 163688 Human
  UniProt ID Q8TD86
• Background: The function of this protein remains unknown.
• Synonyms: CAGLP
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Rat: 79%; Bovine: 79%

Reference Data

• Protein Pathways: Alzheimer's disease, Calcium signaling pathway, Glioma, GnRH signaling pathway, Insulin signaling pathway, Long-term potentiation, Melanogenesis, Neurotrophin signaling pathway, Olfactory transduction, Oocyte meiosis, Phosphatidylinositol signaling system, Vascular smooth muscle contraction