Antibodies

Jump to Filters
View as table Download
CAPN8 Rabbit Polyclonal Antibody
TA331199

USD 375.00

5 Days

Rabbit Polyclonal Anti-CAPN8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CAPN8 antibody is: synthetic peptide directed towards the middle region of Human CAPN8. Synthetic peptide located within the following region: KLIRLRNPWGEVEWSGAWSDDAPEWNHIDPRRKEELDKKVEDGEFWMSLS