CAPN8 Rabbit Polyclonal Antibody

CAT#: TA331199

Rabbit Polyclonal Anti-CAPN8 Antibody

Product Images

WB Suggested Anti-CAPN8 Antibody; Titration: 1.0 ug/ml; Positive Control: Hela Whole cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CAPN8 antibody is: synthetic peptide directed towards the middle region of Human CAPN8. Synthetic peptide located within the following region: KLIRLRNPWGEVEWSGAWSDDAPEWNHIDPRRKEELDKKVEDGEFWMSLS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: calpain 8
• Database Link:
  NP_001137434
  Entrez Gene 388743 Human
  UniProt ID A6NHC0
• Background: CAPN8 is a calcium-regulated non-lysosomal thiol-protease. CAPN8 is involved in membrane trafficking in the gastric surface mucus cells (pit cells) and may involve the membrane trafficking of mucus cells via interactions with coat protein. CAPN8 proteolytically cleaves the beta-subunit of coatomer complex.
• Synonyms: nCL-2
• Note: Human: 100%; Rat: 93%; Rabbit: 93%; Pig: 79%; Horse: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome