Rabbit Polyclonal Anti-Ccdc59 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ccdc59 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ccdc59. Synthetic peptide located within the following region: KRAAKKFEFEMRKQEREEAQRLYKKKKMEAFKILSKKTKKGQPNLNLQME |
Rabbit Polyclonal Anti-CCDC59 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CCDC59 Antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC59. Synthetic peptide located within the following region: EPLFEDQCSFDQPQPEEQCIKTVNSFTIPKKNKKKTSNQKAQEEYEQIQA |
CCDC59 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-241 of human CCDC59 (NP_054886.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China